Key Characteristics
- Category: Injectable Peptides
- Purity: >99% Purity
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493.3 g/mol
- Sequence: [LL-37, 37 aa]
Available Sizes
About
LL-37 is a naturally occurring antimicrobial peptide and a key component of the innate immune system. It possesses broad-spectrum antimicrobial, anti-inflammatory, and wound-healing properties.
Mechanism of Action
LL-37 disrupts the cell membranes of bacteria, fungi, and some viruses, leading to their death. It also modulates the host's immune response, reducing inflammation, and promoting angiogenesis and tissue regeneration to accelerate wound healing.
Key Benefits
- Broad-spectrum antimicrobial activity
- Potent anti-inflammatory and immunomodulatory effects
- Accelerates wound healing
- Can disrupt bacterial biofilms
Clinical Research
LL-37 is extensively studied for its role in infectious diseases, chronic inflammatory conditions (like rosacea), and wound care. Its dual role in fighting infection and promoting healing makes it a high-interest research peptide.
Potential Side Effects
LL-37 is a natural part of the human immune system. When used exogenously, it can cause localized inflammation and pain at the injection site as it recruits immune cells.
Usage & Dosage
Used topically for wound healing or administered via subcutaneous injection for systemic effects. Dosages and protocols are highly dependent on the research application.
Peptide Storage
Best Practices For Storing Peptides
To preserve the integrity of laboratory results, proper storage of peptides is essential. Correct storage practices can maintain peptides for years and guard against contamination, oxidation, and degradation. If the peptides will be used immediately, short-term refrigeration under 4°C (39°F) is generally acceptable. Lyophilized peptides are usually stable at room temperatures for several weeks.
For longer-term storage (several months to years), it is preferable to store peptides in a freezer at -80°C (-112°F). Avoid repeated freeze-thaw cycles and do not use frost-free freezers, as temperatures can fluctuate widely.
Preventing Contamination
To prevent moisture contamination, allow the peptide to come to room temperature before opening its container. Minimize exposure to air; after use, reseal the container under an atmosphere of dry, inert gas (like nitrogen or argon) if possible. Peptides with Cys, Met, or Trp are especially prone to air oxidation.
Storing Peptides In Solution
The shelf life of peptide solutions is far less than that of lyophilized peptides. If peptides must be stored in solution, use sterile buffers at pH 5-6 and separate into aliquots to avoid repeated freezing and thawing. Peptide solutions are generally stable for up to 30 days when refrigerated at 4°C (39°F).